NCBI

From Organic Design wiki
Revision as of 05:01, 5 May 2007 by Sven (talk | contribs) (Regular expressions matching parts we care about: FASTA desc)

Genbank is a flat file database structure for primary nucleotide sequence information and auxillary information. These records can display the ORIGIN information for different nucleotide molecular types, and have no limit on the length of sequence displayed. Entire chromosomes can be stored as a genbank record for an organism of interest, potentially making the disk storage of the record very large.

An example Genbank sample record

Regular expressions matching parts we care about

Genbank

FASTA

There is a condensed file format called a FASTA format is usded to manipulate primary sequence information. FASTA files can be nucleotide or amino acid records. the first row of the record starts with a '>' can contain any description information about the record. It is recommended that all lines of text be shorter than 80 characters in length.

An example of an amino acid FASTA record, in this case the description information is a consise format separated by pipe characters '|'. The second field is the ACCESSION number refering to the amino acid GENPEPT record.

>gi|532319|pir|TVFV2E|TVFV2E envelope protein
ELRLRYCAPAGFALLKCNDADYDGFKTNCSNVSVVHCTNLMNTTVTTGLLLNGSYSENRT
QIWQKHRTSNDSALILLNKHYNLTVTCKRPGNKTVLPVTIMAGLVFHSQKYNLRLRQAWC
HFPSNWKGAWKEVKEEIVNLPKERYRGTNDPKRIFFQRQWGDPETANLWFNCHGEFFYCK
MDWFLNYLNNLTVDADHNECKNTSGTKSGNKRAPGPCVQRTYVACHIRSVIIWLETISKK
TYAPPREGHLECTSTVTGMTVELNYIPKNRTNVTLSPQIESIWAAELDRYKLVEITPIGF
APTEVRRYTGGHERQKRVPFVXXXXXXXXXXXXXXXXXXXXXXVQSQHLLAGILQQQKNL
LAAVEAQQQMLKLTIWGVK

See also